GLRX5 anticorps (Middle Region)

N° du produit ABIN632427

Cet anticorps anti-GLRX5 est un anticorps Lapin Polyclonal détectant GLRX5 dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour GLRX5 anticorps (Middle Region) (ABIN632427)

Antigène: GLRX5 (Glutaredoxin 5 (GLRX5))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GLRX5 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-GLRX5 anticorps

Épitope: Middle Region

Specificité: GLRX5 antibody was raised against the middle region of GLRX5

Purification: Affinity purified

Immunogène: GLRX5 antibody was raised using the middle region of GLRX5 corresponding to a region with amino acids NAVVQILRLHGVRDYAAYNVLDDPELRQGIKDYSNWPTIPQVYLNGEFVG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GLRX5 Blocking Peptide, (ABIN5613787), is also available for use as a blocking control in assays to test for specificity of this GLRX5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLRX5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GLRX5

Antigène: GLRX5 (Glutaredoxin 5 (GLRX5))

Autre désignation: GLRX5

Sujet: Defects in GLRX5 are the cause of anemia sideroblastic pyridoxine-refractory autosomal recessive (PRARSA). The specific function of GLRX5 is not yet known.

Poids moléculaire: 16 kDa (MW of target protein)

Pathways: Cell RedoxHomeostasis