GLRX5 anticorps (Middle Region)
-
- Antigène Voir toutes GLRX5 Anticorps
- GLRX5 (Glutaredoxin 5 (GLRX5))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GLRX5 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- GLRX5 antibody was raised against the middle region of GLRX5
- Purification
- Affinity purified
- Immunogène
- GLRX5 antibody was raised using the middle region of GLRX5 corresponding to a region with amino acids NAVVQILRLHGVRDYAAYNVLDDPELRQGIKDYSNWPTIPQVYLNGEFVG
- Top Product
- Discover our top product GLRX5 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GLRX5 Blocking Peptide, catalog no. 33R-6648, is also available for use as a blocking control in assays to test for specificity of this GLRX5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLRX5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- GLRX5 (Glutaredoxin 5 (GLRX5))
- Autre désignation
- GLRX5 (GLRX5 Produits)
- Synonymes
- anticorps grx5, anticorps C14orf87, anticorps FLB4739, anticorps GRX5, anticorps PR01238, anticorps PRO1238, anticorps RGD1308383, anticorps 2310004O13Rik, anticorps 2900070E19Rik, anticorps AU020725, anticorps id:ibd5119, anticorps wu:fa09g08, anticorps zgc:73343, anticorps glutaredoxin 5 L homeolog, anticorps glutaredoxin 5, anticorps glutaredoxin 5 homolog (S. cerevisiae), anticorps glrx5.L, anticorps GLRX5, anticorps Glrx5, anticorps glrx5
- Sujet
- Defects in GLRX5 are the cause of anemia sideroblastic pyridoxine-refractory autosomal recessive (PRARSA). The specific function of GLRX5 is not yet known.
- Poids moléculaire
- 16 kDa (MW of target protein)
- Pathways
- Cell RedoxHomeostasis
-