PDP2 anticorps (Middle Region)
-
- Antigène Voir toutes PDP2 Anticorps
- PDP2 (Pyruvate Dehyrogenase Phosphatase Catalytic Subunit 2 (PDP2))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PDP2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PDP2 antibody was raised against the middle region of PDP2
- Purification
- Affinity purified
- Immunogène
- PDP2 antibody was raised using the middle region of PDP2 corresponding to a region with amino acids CRAILGVQEDNGMWSCLPLTRDHNAWNQAELSRLKREHPESEDRTIIMED
- Top Product
- Discover our top product PDP2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PDP2 Blocking Peptide, catalog no. 33R-1790, is also available for use as a blocking control in assays to test for specificity of this PDP2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDP2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PDP2 (Pyruvate Dehyrogenase Phosphatase Catalytic Subunit 2 (PDP2))
- Autre désignation
- PDP2 (PDP2 Produits)
- Synonymes
- anticorps PDP2, anticorps DKFZp459I1928, anticorps 4833426J09Rik, anticorps Gm1705, anticorps mKIAA1348, anticorps PPM2C2, anticorps pyruvate dehyrogenase phosphatase catalytic subunit 2, anticorps PDP2, anticorps pdp2, anticorps Pdp2
- Sujet
- PDP2 catalyzes the dephosphorylation and concomitant reactivation of the alpha subunit of the E1 component of the pyruvate dehydrogenase complex.
- Poids moléculaire
- 60 kDa (MW of target protein)
-