SPATA16 anticorps (N-Term)

N° du produit ABIN632429

Détail du produit anti-SPATA16 anticorps

Antigène: SPATA16 (Spermatogenesis Associated 16 (SPATA16))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SPATA16 est non-conjugé

Application: Western Blotting (WB)

Specificité: SPATA16 antibody was raised against the N terminal of SPATA16

Purification: Affinity purified

Immunogène: SPATA16 antibody was raised using the N terminal of SPATA16 corresponding to a region with amino acids MDAGSSRSLENAVNRIYHDQLVPKINTSKKMSTLAHPPNILEMSQEIKKN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SPATA16 Blocking Peptide, catalog no. 33R-5820, is also available for use as a blocking control in assays to test for specificity of this SPATA16 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPATA16 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SPATA16

Antigène: SPATA16 (Spermatogenesis Associated 16 (SPATA16))

Autre désignation: SPATA16 (SPATA16 Produits)

Synonymes: anticorps RGD1563726, anticorps NYD-SP12, anticorps SPGF6, anticorps 4921511F01Rik, anticorps 4930503K02Rik, anticorps Nyd-sp12, anticorps spermatogenesis associated 16, anticorps Spata16, anticorps SPATA16

Sujet: SPATA16 is involved in the formation of sperm acrosome, which implicated its potential role in spermatogenesis and sperm-egg fusion. Defects in SPATA16 are a cause of globozoospermia, also called Round-headed spermatozoa.

Poids moléculaire: 63 kDa (MW of target protein)