COBLL1 anticorps (N-Term)

N° du produit ABIN632436

Détail du produit anti-COBLL1 anticorps

Antigène: COBLL1 (COBL-Like 1 (COBLL1))

Épitope: N-Term

Reactivité: Humain, Chien, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp COBLL1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: Cobl-Like 1 antibody was raised against the N terminal of COBLL1

Purification: Affinity purified

Immunogène: Cobl-Like 1 antibody was raised using the N terminal of COBLL1 corresponding to a region with amino acids SAPATPLVNKHRPTFTRSNTISKPYISNTLPSDAPKKRRAPLPPMPASQS

Information d'application

Indications d'application: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Cobl-Like 1 Blocking Peptide, catalog no. 33R-8308, is also available for use as a blocking control in assays to test for specificity of this Cobl-Like 1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COBLL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur COBLL1

Antigène: COBLL1 (COBL-Like 1 (COBLL1))

Autre désignation: Cobl-Like 1 (COBLL1 Produits)

Synonymes: anticorps DKFZp468N1516, anticorps 1810047P18Rik, anticorps Coblr1, anticorps D430044D16Rik, anticorps COBLR1, anticorps cordon-bleu WH2 repeat protein like 1, anticorps cordon-bleu protein-like 1, anticorps Cobl-like 1, anticorps cordon-bleu WH2 repeat protein-like 1, anticorps COBLL1, anticorps LOC100546808, anticorps Cobll1

Sujet: The function of this gene remains unknown.

Poids moléculaire: 128 kDa (MW of target protein)