Exophilin 5 anticorps (Middle Region)

N° du produit ABIN632437

Cet anticorps Lapin Polyclonal détecte spécifiquement Exophilin 5 dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour Exophilin 5 anticorps (Middle Region) (ABIN632437)

Antigène: Exophilin 5 (EXPH5)

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Exophilin 5 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Exophilin 5 anticorps

Épitope: Middle Region

Specificité: EXPH5 antibody was raised against the middle region of EXPH5

Purification: Affinity purified

Immunogène: EXPH5 antibody was raised using the middle region of EXPH5 corresponding to a region with amino acids QGRLWKPSFLKNPGFLKDDLRNPPNPSESLSSNSPSSQVPEDGLSPSEPL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EXPH5 Blocking Peptide, (ABIN5613438), is also available for use as a blocking control in assays to test for specificity of this EXPH5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EXPH5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Exophilin 5

Antigène: Exophilin 5 (EXPH5)

Autre désignation: EXPH5

Sujet: EXPH5 may act as a Rab effector protein and play a role in vesicle trafficking.

Poids moléculaire: 222 kDa (MW of target protein)