GTPBP2 anticorps (N-Term)

N° du produit ABIN632438

L’anticorps Lapin Polyclonal anti-GTPBP2 a été validé pour WB. Il convient pour détecter GTPBP2 dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour GTPBP2 anticorps (N-Term) (ABIN632438)

Antigène: GTPBP2 (GTP Binding Protein 2 (GTPBP2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GTPBP2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-GTPBP2 anticorps

Épitope: N-Term

Specificité: GTPBP2 antibody was raised against the N terminal of GTPBP2

Purification: Affinity purified

Immunogène: GTPBP2 antibody was raised using the N terminal of GTPBP2 corresponding to a region with amino acids GCGGPKGKKKNGRNRGGKANNPPYLPPEAEDGNIEYKLKLVNPSQYRFEH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GTPBP2 Blocking Peptide, (ABIN938571), is also available for use as a blocking control in assays to test for specificity of this GTPBP2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GTPBP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GTPBP2

Antigène: GTPBP2 (GTP Binding Protein 2 (GTPBP2))

Autre désignation: GTPBP2

Sujet: GTP-binding proteins, or G proteins, constitute a superfamily capable of binding GTP or GDP. G proteins are activated by binding GTP and are inactivated by hydrolyzing GTP to GDP. This general mechanism enables G proteins to perform a wide range of biologic activities.

Poids moléculaire: 66 kDa (MW of target protein)