BEND7 anticorps (N-Term)

N° du produit ABIN632443

Détail du produit anti-BEND7 anticorps

Antigène: BEND7 (BEN Domain Containing 7 (BEND7))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp BEND7 est non-conjugé

Application: Western Blotting (WB)

Specificité: C10 orf30 antibody was raised against the N terminal of C10 rf30

Purification: Affinity purified

Immunogène: C10 orf30 antibody was raised using the N terminal of C10 rf30 corresponding to a region with amino acids AGSNCCTCNCQSTLQAILQELKTMRKLMQIQAVGTQNRQQPPISLICSQR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C10orf30 Blocking Peptide, catalog no. 33R-1224, is also available for use as a blocking control in assays to test for specificity of this C10orf30 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 rf30 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur BEND7

Antigène: BEND7 (BEN Domain Containing 7 (BEND7))

Autre désignation: C10orf30 (BEND7 Produits)

Synonymes: anticorps C10orf30, anticorps 1110017O21Rik, anticorps E130319B15Rik, anticorps RGD1305898, anticorps BEN domain containing 7, anticorps si:ch211-220f12.4, anticorps BEND7, anticorps si:ch211-220f12.4, anticorps Bend7

Sujet: The function of Chromosome 10 ORF protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 51 kDa (MW of target protein)