EIF5A2 anticorps (N-Term)

N° du produit ABIN632450

L’anticorps Lapin Polyclonal anti-EIF5A2 a été validé pour WB. Il convient pour détecter EIF5A2 dans des échantillons de Humain.

Aperçu rapide pour EIF5A2 anticorps (N-Term) (ABIN632450)

Antigène: EIF5A2 (Eukaryotic Translation Initiation Factor 5A2 (EIF5A2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EIF5A2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-EIF5A2 anticorps

Épitope: N-Term

Specificité: EIF5 A2 antibody was raised against the N terminal of EIF5 2

Purification: Affinity purified

Immunogène: EIF5 A2 antibody was raised using the N terminal of EIF5 2 corresponding to a region with amino acids MADEIDFTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EIF5A2 Blocking Peptide, (ABIN5613352), is also available for use as a blocking control in assays to test for specificity of this EIF5A2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur EIF5A2

Antigène: EIF5A2 (Eukaryotic Translation Initiation Factor 5A2 (EIF5A2))

Autre désignation: EIF5A2

Sujet: EIF5A2 is a mRNA-binding protein involved in translation elongation. EIF5A2 has an important function at the level of mRNA turnover, probably acting downstream of decapping.

Poids moléculaire: 17 kDa (MW of target protein)