EIF5A2 anticorps (N-Term)

N° du produit ABIN632450

Détail du produit anti-EIF5A2 anticorps

Antigène: EIF5A2 (Eukaryotic Translation Initiation Factor 5A2 (EIF5A2))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EIF5A2 est non-conjugé

Application: Western Blotting (WB)

Specificité: EIF5 A2 antibody was raised against the N terminal of EIF5 2

Purification: Affinity purified

Immunogène: EIF5 A2 antibody was raised using the N terminal of EIF5 2 corresponding to a region with amino acids MADEIDFTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EIF5A2 Blocking Peptide, catalog no. 33R-5619, is also available for use as a blocking control in assays to test for specificity of this EIF5A2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur EIF5A2

Antigène: EIF5A2 (Eukaryotic Translation Initiation Factor 5A2 (EIF5A2))

Autre désignation: EIF5A2 (EIF5A2 Produits)

Synonymes: anticorps EIF5A2, anticorps EIF5A, anticorps zgc:55504, anticorps zgc:77429, anticorps wu:fb05b06, anticorps wu:fc23f04, anticorps wu:fc61c10, anticorps EIF-5A2, anticorps eIF5AII, anticorps 9630038B20, anticorps eukaryotic translation initiation factor 5A2, anticorps eukaryotic translation initiation factor 5A3, anticorps EIF5A2, anticorps eif5a2, anticorps LOC100499632, anticorps Eif5a2

Sujet: EIF5A2 is a mRNA-binding protein involved in translation elongation. EIF5A2 has an important function at the level of mRNA turnover, probably acting downstream of decapping.

Poids moléculaire: 17 kDa (MW of target protein)