AHCYL1 anticorps (N-Term)

N° du produit ABIN632455

Cet anticorps Lapin Polyclonal détecte spécifiquement AHCYL1 dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour AHCYL1 anticorps (N-Term) (ABIN632455)

Antigène: AHCYL1 (Adenosylhomocysteinase-Like 1 (AHCYL1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp AHCYL1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-AHCYL1 anticorps

Épitope: N-Term

Specificité: AHCYL1 antibody was raised against the N terminal of AHCYL1

Purification: Affinity purified

Immunogène: AHCYL1 antibody was raised using the N terminal of AHCYL1 corresponding to a region with amino acids TDSYSSAASYTDSSDDEVSPREKQQTNSKGSSNFCVKNIKQAEFGRREIE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

AHCYL1 Blocking Peptide, (ABIN5611979), is also available for use as a blocking control in assays to test for specificity of this AHCYL1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AHCYL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur AHCYL1

Antigène: AHCYL1 (Adenosylhomocysteinase-Like 1 (AHCYL1))

Autre désignation: AHCYL1

Sujet: The protein, an inositol 1,4,5-trisphosphate receptor-binding protein, specifically binds to and activates pancreas-type Na+/HCO3- cotransporter 1 (pNBC1).

Poids moléculaire: 59 kDa (MW of target protein)