Destrin anticorps

N° du produit ABIN632457

Cet anticorps anti-Destrin est un anticorps Lapin Polyclonal détectant Destrin dans WB. Adapté pour Humain, Rat et Souris.

Aperçu rapide pour Destrin anticorps (ABIN632457)

Antigène: Destrin (DSTN) (Destrin (Actin Depolymerizing Factor) (DSTN))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Destrin est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Destrin anticorps

Purification: Affinity purified

Immunogène: Destrin antibody was raised using a synthetic peptide corresponding to a region with amino acids ASGVQVADEVCRIFYDMKVRKCSTPEEIKKRKKAVIFCLSADKKCIIVEE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Destrin Blocking Peptide, (ABIN936896), is also available for use as a blocking control in assays to test for specificity of this Destrin antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DSTN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Destrin

Antigène: Destrin (DSTN) (Destrin (Actin Depolymerizing Factor) (DSTN))

Autre désignation: Destrin

Sujet: DSTN belongs to the actin-binding proteins ADF family. This family of proteins is responsible for enhancing the turnover rate of actin in vivo. It is the actin depolymerizing protein that severs actin filaments (F-actin) and binds to actin monomers (G-actin).

Poids moléculaire: 18 kDa (MW of target protein)