GBX1 anticorps (Middle Region)

N° du produit ABIN632458

Cet anticorps Lapin Polyclonal détecte spécifiquement GBX1 dans WB. Il présente une réactivité envers Souris, Rat, Humain et Drosophila melanogaster.

Aperçu rapide pour GBX1 anticorps (Middle Region) (ABIN632458)

Antigène: GBX1 (Gastrulation Brain Homeobox 1 (GBX1))

Reactivité: Souris, Rat, Humain, Drosophila melanogaster

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GBX1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-GBX1 anticorps

Épitope: Middle Region

Specificité: GBX1 antibody was raised against the middle region of Gbx-1

Purification: Affinity purified

Immunogène: GBX1 antibody was raised using the middle region of Gbx-1 corresponding to a region with amino acids AKWKRIKAGNVSSRSGEPVRNPKIVVPIPVHVNRFAVRSQHQQMEQGARP

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GBX1 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this GBX1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GBX-1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GBX1

Antigène: GBX1 (Gastrulation Brain Homeobox 1 (GBX1))

Autre désignation: GBX1

Sujet: GBX-1 contains 1 homeobox DNA-binding domain. The exact functions of GBX-1 remain unknown.

Poids moléculaire: 40 kDa (MW of target protein)