C9orf25 anticorps (Middle Region)

N° du produit ABIN632464

Cet anticorps Lapin Polyclonal détecte spécifiquement C9orf25 dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour C9orf25 anticorps (Middle Region) (ABIN632464)

Antigène: C9orf25 (Chromosome 9 Open Reading Frame 25 (C9orf25))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C9orf25 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-C9orf25 anticorps

Épitope: Middle Region

Specificité: C9 ORF25 antibody was raised against the middle region of C9 rf25

Purification: Affinity purified

Immunogène: C9 ORF25 antibody was raised using the middle region of C9 rf25 corresponding to a region with amino acids SSSGYSSAEQINQDLNIQLLKDGYRLDEIPDDEDLDLIPPKSVNPTCMCC

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C9ORF25 Blocking Peptide, (ABIN5612548), is also available for use as a blocking control in assays to test for specificity of this C9ORF25 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF25 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C9orf25

Antigène: C9orf25 (Chromosome 9 Open Reading Frame 25 (C9orf25))

Autre désignation: C9ORF25

Sujet: The protein encoded by this gene has homologs that have been identified in mouse and macaque. The mouse and human proteins have a putative prenyl group binding site (CAAX box) at their C-terminus. A diverse list of proteins are known or strongly presumed to be the target of post-translational modification by the attachment of either a farnesyl or a geranyl-geranyl group to a cysteine residue at the C-terminus.

Poids moléculaire: 18 kDa (MW of target protein)