FAM135B anticorps (Middle Region)

N° du produit ABIN632470

Cet anticorps Lapin Polyclonal détecte spécifiquement FAM135B dans WB. Il présente une réactivité avec des échantillons de Humain et Rat.

Aperçu rapide pour FAM135B anticorps (Middle Region) (ABIN632470)

Antigène: FAM135B (Family with Sequence Similarity 135, Member B (FAM135B))

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FAM135B est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-FAM135B anticorps

Épitope: Middle Region

Specificité: FAM135 B antibody was raised against the middle region of FAM135

Purification: Affinity purified

Immunogène: FAM135 B antibody was raised using the middle region of FAM135 corresponding to a region with amino acids TLVSTGLWLMQKLKKSGSLLQLTFRDNADLRKCFLYQLSQKTGLQYFKNV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FAM135B Blocking Peptide, (ABIN5613471), is also available for use as a blocking control in assays to test for specificity of this FAM135B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM130 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FAM135B

Antigène: FAM135B (Family with Sequence Similarity 135, Member B (FAM135B))

Autre désignation: FAM135B

Sujet: The function of FAM135 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 156 kDa (MW of target protein)