FAM135B anticorps (Middle Region)

N° du produit ABIN632470

Détail du produit anti-FAM135B anticorps

Antigène: FAM135B (Family with Sequence Similarity 135, Member B (FAM135B))

Épitope: Middle Region

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FAM135B est non-conjugé

Application: Western Blotting (WB)

Specificité: FAM135 B antibody was raised against the middle region of FAM135

Purification: Affinity purified

Immunogène: FAM135 B antibody was raised using the middle region of FAM135 corresponding to a region with amino acids TLVSTGLWLMQKLKKSGSLLQLTFRDNADLRKCFLYQLSQKTGLQYFKNV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FAM135B Blocking Peptide, catalog no. 33R-9192, is also available for use as a blocking control in assays to test for specificity of this FAM135B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM130 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FAM135B

Antigène: FAM135B (Family with Sequence Similarity 135, Member B (FAM135B))

Autre désignation: FAM135B (FAM135B Produits)

Synonymes: anticorps MGC81353, anticorps C8ORFK32, anticorps RGD1308133, anticorps 1700010C24Rik, anticorps A830008O07Rik, anticorps family with sequence similarity 135 member B, anticorps family with sequence similarity 135 member B L homeolog, anticorps family with sequence similarity 135, member B, anticorps FAM135B, anticorps fam135b.L, anticorps Fam135b

Sujet: The function of FAM135 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 156 kDa (MW of target protein)