TRAPPC2L anticorps (N-Term)

N° du produit ABIN632473

Cet anticorps Lapin Polyclonal détecte spécifiquement TRAPPC2L dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour TRAPPC2L anticorps (N-Term) (ABIN632473)

Antigène: TRAPPC2L

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TRAPPC2L est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TRAPPC2L anticorps

Épitope: N-Term

Specificité: TRAPPC2 L antibody was raised against the N terminal of TRAPPC2

Purification: Affinity purified

Immunogène: TRAPPC2 L antibody was raised using the N terminal of TRAPPC2 corresponding to a region with amino acids MAVCIAVIAKENYPLYIRSTPTENELKFHYMVHTSLDVVDEKISAMGKAL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TRAPPC2L Blocking Peptide, (ABIN5616767), is also available for use as a blocking control in assays to test for specificity of this TRAPPC2L antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRAPPC0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TRAPPC2L

Antigène: TRAPPC2L

Sujet: TRAPPC2L may play a role in vesicular transport from endoplasmic reticulum to Golgi.

Poids moléculaire: 16 kDa (MW of target protein)