TMCO6 anticorps (N-Term)

N° du produit ABIN632475

Cet anticorps anti-TMCO6 est un anticorps Lapin Polyclonal détectant TMCO6 dans WB. Adapté pour Humain.

Aperçu rapide pour TMCO6 anticorps (N-Term) (ABIN632475)

Antigène: TMCO6 (Transmembrane and Coiled-Coil Domains 6 (TMCO6))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMCO6 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TMCO6 anticorps

Épitope: N-Term

Specificité: TMCO6 antibody was raised against the N terminal of TMCO6

Purification: Affinity purified

Immunogène: TMCO6 antibody was raised using the N terminal of TMCO6 corresponding to a region with amino acids LRQAQRGTEEKEREGALVSLRRGLQHPETQQTFIRLEGSMRTLVGLLTSN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMCO6 Blocking Peptide, (ABIN5616651), is also available for use as a blocking control in assays to test for specificity of this TMCO6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMCO6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMCO6

Antigène: TMCO6 (Transmembrane and Coiled-Coil Domains 6 (TMCO6))

Autre désignation: TMCO6

Sujet: The function of TMCO6 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 54 kDa (MW of target protein)