ACP1 anticorps (Middle Region)

N° du produit ABIN632483

L’anticorps anti-ACP1 Polyclonal Lapin est utilisé pour la détection de ACP1 dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour ACP1 anticorps (Middle Region) (ABIN632483)

Antigène: ACP1 (Acid Phosphatase 1, Soluble (ACP1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ACP1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ACP1 anticorps

Épitope: Middle Region

Specificité: ACP1 antibody was raised against the middle region of ACP1

Purification: Affinity purified

Immunogène: ACP1 antibody was raised using the middle region of ACP1 corresponding to a region with amino acids NISENWVIDSGAVSDWNVGRSPDPRAVSCLRNHGIHTAHKARQITKEDFA

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ACP1 Blocking Peptide, (ABIN5611910), is also available for use as a blocking control in assays to test for specificity of this ACP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ACP1

Antigène: ACP1 (Acid Phosphatase 1, Soluble (ACP1))

Autre désignation: ACP1

Sujet: ACP1 belongs to the phosphotyrosine protein phosphatase family of proteins. It functions as an acid phosphatase and a protein tyrosine phosphatase by hydrolyzing protein tyrosine phosphate to protein tyrosine and orthophosphate. This enzyme also hydrolyzes orthophosphoric monoesters to alcohol and orthophosphate.

Poids moléculaire: 18 kDa (MW of target protein)