PRPS2 anticorps (Middle Region)

N° du produit ABIN632490

Cet anticorps anti-PRPS2 est un anticorps Lapin Polyclonal détectant PRPS2 dans WB et IHC. Adapté pour Humain, Rat, Souris, Chien, Poisson zèbre (Danio rerio) et Drosophila melanogaster.

Aperçu rapide pour PRPS2 anticorps (Middle Region) (ABIN632490)

Antigène: PRPS2 (phosphoribosyl Pyrophosphate Synthetase 2 (PRPS2))

Reactivité: Humain, Rat, Souris, Chien, Poisson zèbre (Danio rerio), Drosophila melanogaster

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PRPS2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-PRPS2 anticorps

Épitope: Middle Region

Specificité: PRPS2 antibody was raised against the middle region of PRPS2

Purification: Affinity purified

Immunogène: PRPS2 antibody was raised using the middle region of PRPS2 corresponding to a region with amino acids VSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVDRMVLVGDVKDRVAI

Information d'application

Indications d'application: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PRPS2 Blocking Peptide, (ABIN5615587), is also available for use as a blocking control in assays to test for specificity of this PRPS2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRPS2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PRPS2

Antigène: PRPS2 (phosphoribosyl Pyrophosphate Synthetase 2 (PRPS2))

Autre désignation: PRPS2

Sujet: PRPS2 is a phosphoribosyl pyrophosphate synthetase that plays a central role in the synthesis of purines and pyrimidines. The PRPS2 protein catalyzes the synthesis of 5-phosphoribosyl 1-pyrophosphate from ATP and D-ribose 5-phosphate.

Poids moléculaire: 35 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process