ADH1A anticorps
-
- Antigène Voir toutes ADH1A Anticorps
- ADH1A (Alcohol Dehydrogenase 1A (Class I), alpha Polypeptide (ADH1A))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ADH1A est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- ADH1 A antibody was raised using a synthetic peptide corresponding to a region with amino acids ESNYCLKNDVSNPQGTLQDGTSRFTCRRKPIHHFLGISTFSQYTVVDENA
- Top Product
- Discover our top product ADH1A Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ADH1A Blocking Peptide, catalog no. 33R-2739, is also available for use as a blocking control in assays to test for specificity of this ADH1A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADH0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ADH1A (Alcohol Dehydrogenase 1A (Class I), alpha Polypeptide (ADH1A))
- Autre désignation
- ADH1A (ADH1A Produits)
- Synonymes
- anticorps ADC1, anticorps ADH1, anticorps ADH, anticorps ARVP, anticorps AVP-NPII, anticorps AVRP, anticorps VP, anticorps adh-1, anticorps ADH-AA, anticorps AI194826, anticorps Adh-1, anticorps Adh-1-t, anticorps Adh-1e, anticorps Adh-1t, anticorps Adh-3e, anticorps Adh1-e, anticorps Adh1-t, anticorps Adh1tl, anticorps Adh3-e, anticorps Adh, anticorps Adh1a, anticorps Adh1c, anticorps Adh1, anticorps Dvir\\Adh, anticorps Dvir\\GJ18208, anticorps GJ18208, anticorps dvir_GLEANR_2771, anticorps ADH-1, anticorps ADH1B, anticorps alcohol dehydrogenase ADH1, anticorps alcohol dehydrogenase 1A (class I), alpha polypeptide, anticorps arginine vasopressin, anticorps alcohol dehydrogenase 1, anticorps alcohol dehydrogenase 1A, anticorps alcohol dehydrogenase 1 (class I), anticorps Alcohol dehydrogenase 1, anticorps alcohol dehydrogenase 1C (class I), gamma polypeptide, anticorps ADH1, anticorps ADH1A, anticorps AVP, anticorps adh1, anticorps LOC744064, anticorps Adh1, anticorps Dvir\Adh1, anticorps ADH1C
- Sujet
- ADH1A is class I alcohol dehydrogenase, alpha subunit, which is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class I alcohol dehydrogenase, consisting of several homo- and heterodimers of alpha, beta, and gamma subunits, exhibits high activity for ethanol oxidation and plays a major role in ethanol catabolism.
- Poids moléculaire
- 40 kDa (MW of target protein)
-