ADH1A anticorps

N° du produit ABIN632492

Détail du produit anti-ADH1A anticorps

Antigène: ADH1A (Alcohol Dehydrogenase 1A (Class I), alpha Polypeptide (ADH1A))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ADH1A est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: ADH1 A antibody was raised using a synthetic peptide corresponding to a region with amino acids NYCLKNDVSNPQGTLQDGTSRFTCRRKPIHHFLGISTFSQYTVVDENAVA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ADH1A Blocking Peptide, catalog no. 33R-6935, is also available for use as a blocking control in assays to test for specificity of this ADH1A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADH0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ADH1A

Antigène: ADH1A (Alcohol Dehydrogenase 1A (Class I), alpha Polypeptide (ADH1A))

Autre désignation: ADH1A (ADH1A Produits)

Synonymes: anticorps ADC1, anticorps ADH1, anticorps ADH, anticorps ARVP, anticorps AVP-NPII, anticorps AVRP, anticorps VP, anticorps adh-1, anticorps ADH-AA, anticorps AI194826, anticorps Adh-1, anticorps Adh-1-t, anticorps Adh-1e, anticorps Adh-1t, anticorps Adh-3e, anticorps Adh1-e, anticorps Adh1-t, anticorps Adh1tl, anticorps Adh3-e, anticorps Adh, anticorps Adh1a, anticorps Adh1c, anticorps Adh1, anticorps Dvir\\Adh, anticorps Dvir\\GJ18208, anticorps GJ18208, anticorps dvir_GLEANR_2771, anticorps ADH-1, anticorps ADH1B, anticorps alcohol dehydrogenase ADH1, anticorps alcohol dehydrogenase 1A (class I), alpha polypeptide, anticorps arginine vasopressin, anticorps alcohol dehydrogenase 1, anticorps alcohol dehydrogenase 1A, anticorps alcohol dehydrogenase 1 (class I), anticorps Alcohol dehydrogenase 1, anticorps alcohol dehydrogenase 1C (class I), gamma polypeptide, anticorps ADH1, anticorps ADH1A, anticorps AVP, anticorps adh1, anticorps LOC744064, anticorps Adh1, anticorps Dvir\Adh1, anticorps ADH1C

Sujet: ADH1A is class I alcohol dehydrogenase, alpha subunit, which is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class I alcohol dehydrogenase, consisting of several homo- and heterodimers of alpha, beta, and gamma subunits, exhibits high activity for ethanol oxidation and plays a major role in ethanol catabolism.

Poids moléculaire: 40 kDa (MW of target protein)