MAGEA10 anticorps (Middle Region)
-
- Antigène Voir toutes MAGEA10 Anticorps
- MAGEA10 (Melanoma Antigen Family A, 10 (MAGEA10))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MAGEA10 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- MAGEA10 antibody was raised against the middle region of MAGEA10
- Purification
- Affinity purified
- Immunogène
- MAGEA10 antibody was raised using the middle region of MAGEA10 corresponding to a region with amino acids NMMGLYDGMEHLIYGEPRKLLTQDWVQENYLEYRQVPGSDPARYEFLWGP
- Top Product
- Discover our top product MAGEA10 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
MAGEA10 Blocking Peptide, catalog no. 33R-6797, is also available for use as a blocking control in assays to test for specificity of this MAGEA10 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAGEA10 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MAGEA10 (Melanoma Antigen Family A, 10 (MAGEA10))
- Autre désignation
- MAGEA10 (MAGEA10 Produits)
- Synonymes
- anticorps MAGEA10, anticorps CT1.10, anticorps MAGE10, anticorps RGD1563693, anticorps MAGEA11, anticorps MAGE family member A10, anticorps melanoma-associated antigen 10, anticorps melanoma antigen family A, 10, anticorps putative MAGE domain-containing protein MAGEA13P, anticorps MAGEA10, anticorps LOC509805, anticorps Magea10, anticorps LOC492173
- Sujet
- This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other.
- Poids moléculaire
- 41 kDa (MW of target protein)
-