PSG9 anticorps (N-Term)

N° du produit ABIN632496

Détail du produit anti-PSG9 anticorps

Antigène: PSG9 (Pregnancy Specific beta-1-Glycoprotein 9 (PSG9))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PSG9 est non-conjugé

Application: Western Blotting (WB)

Specificité: PSG9 antibody was raised against the N terminal of PSG9

Purification: Affinity purified

Immunogène: PSG9 antibody was raised using the N terminal of PSG9 corresponding to a region with amino acids YSNASLLIQNVTRKDAGTYTLHIIKRGDETREEIRHFTFTLYLETPKPYI

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PSG9 Blocking Peptide, catalog no. 33R-10245, is also available for use as a blocking control in assays to test for specificity of this PSG9 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSG9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PSG9

Antigène: PSG9 (Pregnancy Specific beta-1-Glycoprotein 9 (PSG9))

Autre désignation: PSG9 (PSG9 Produits)

Synonymes: anticorps PS34, anticorps PSG11, anticorps PSGII, anticorps PSBG-9, anticorps PSBG-11, anticorps pregnancy specific beta-1-glycoprotein 9, anticorps PSG9

Sujet: The human pregnancy-specific glycoproteins (PSGs) are a group of molecules that are mainly produced by the placental syncytiotrophoblasts during pregnancy. PSGs comprise a subgroup of the carcinoembryonic antigen (CEA) family, which belongs to the immunoglobulin superfamily.

Poids moléculaire: 54 kDa (MW of target protein)