TGM4 anticorps

N° du produit ABIN632497

Cet anticorps Lapin Polyclonal détecte spécifiquement TGM4 dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour TGM4 anticorps (ABIN632497)

Antigène: TGM4 (Transglutaminase 4 (Prostate) (TGM4))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TGM4 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TGM4 anticorps

Purification: Affinity purified

Immunogène: Transglutaminase 4 antibody was raised using a synthetic peptide corresponding to a region with amino acids KEDMVFMPDEDERKEYILNDTGCHYVGAARSIKCKPWNFGQFEKNVLDCC

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Transglutaminase 4 Blocking Peptide, (ABIN939706), is also available for use as a blocking control in assays to test for specificity of this Transglutaminase 4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TGM4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TGM4

Antigène: TGM4 (Transglutaminase 4 (Prostate) (TGM4))

Autre désignation: Transglutaminase 4

Sujet: TGM4 is associated with the mammalian reproductive process. TGM4 catalyzes the cross-linking of proteins and the conjugation of polyamines to specific proteins in the seminal tract.

Poids moléculaire: 77 kDa (MW of target protein)