TGM4 anticorps
-
- Antigène Voir toutes TGM4 Anticorps
- TGM4 (Transglutaminase 4 (Prostate) (TGM4))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TGM4 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- Transglutaminase 4 antibody was raised using a synthetic peptide corresponding to a region with amino acids KEDMVFMPDEDERKEYILNDTGCHYVGAARSIKCKPWNFGQFEKNVLDCC
- Top Product
- Discover our top product TGM4 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Transglutaminase 4 Blocking Peptide, catalog no. 33R-4320, is also available for use as a blocking control in assays to test for specificity of this Transglutaminase 4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TGM4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TGM4 (Transglutaminase 4 (Prostate) (TGM4))
- Autre désignation
- Transglutaminase 4 (TGM4 Produits)
- Synonymes
- anticorps LOC100227373, anticorps TGP, anticorps hTGP, anticorps 9530008N10Rik, anticorps Eapa1, anticorps Dp1, anticorps transglutaminase 4, anticorps transglutaminase 4 (prostate), anticorps TGM4, anticorps Tgm4
- Sujet
- TGM4 is associated with the mammalian reproductive process. TGM4 catalyzes the cross-linking of proteins and the conjugation of polyamines to specific proteins in the seminal tract.
- Poids moléculaire
- 77 kDa (MW of target protein)
-