TGM3 anticorps
-
- Antigène Voir toutes TGM3 Anticorps
- TGM3 (Transglutaminase 3 (E Polypeptide, Protein-Glutamine-gamma-Glutamyltransferase) (TGM3))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TGM3 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- Transglutaminase 3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAALGVQSINWQTAFNRQAHHTDKFSSQELILRRGQNFQVLMIMNKGLGS
- Top Product
- Discover our top product TGM3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Transglutaminase 3 Blocking Peptide, catalog no. 33R-5600, is also available for use as a blocking control in assays to test for specificity of this Transglutaminase 3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TGM3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TGM3 (Transglutaminase 3 (E Polypeptide, Protein-Glutamine-gamma-Glutamyltransferase) (TGM3))
- Autre désignation
- Transglutaminase 3 (TGM3 Produits)
- Synonymes
- anticorps TGE, anticorps TG(E), anticorps AI893889, anticorps RGD1561831, anticorps transglutaminase 3, anticorps transglutaminase 3, E polypeptide, anticorps TGM3, anticorps Tgm3
- Sujet
- Transglutaminases are enzymes that catalyze the crosslinking of proteins by epsilon-gamma glutamyl lysine isopeptide bonds.
- Poids moléculaire
- 25 kDa (MW of target protein)
-