TGM3 anticorps

N° du produit ABIN632498

L’anticorps anti-TGM3 Polyclonal Lapin est utilisé pour la détection de TGM3 dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour TGM3 anticorps (ABIN632498)

Antigène: TGM3 (Transglutaminase 3 (E Polypeptide, Protein-Glutamine-gamma-Glutamyltransferase) (TGM3))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TGM3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TGM3 anticorps

Purification: Affinity purified

Immunogène: Transglutaminase 3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAALGVQSINWQTAFNRQAHHTDKFSSQELILRRGQNFQVLMIMNKGLGS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Transglutaminase 3 Blocking Peptide, (ABIN5616759), is also available for use as a blocking control in assays to test for specificity of this Transglutaminase 3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TGM3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TGM3

Antigène: TGM3 (Transglutaminase 3 (E Polypeptide, Protein-Glutamine-gamma-Glutamyltransferase) (TGM3))

Autre désignation: Transglutaminase 3

Sujet: Transglutaminases are enzymes that catalyze the crosslinking of proteins by epsilon-gamma glutamyl lysine isopeptide bonds.

Poids moléculaire: 25 kDa (MW of target protein)