MYH1 anticorps (N-Term)

N° du produit ABIN632502

Cet anticorps anti-MYH1 est un anticorps Lapin Polyclonal détectant MYH1 dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour MYH1 anticorps (N-Term) (ABIN632502)

Antigène: MYH1 (Myosin Heavy Chain 1, Skeletal Muscle, Adult (MYH1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MYH1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-MYH1 anticorps

Épitope: N-Term

Specificité: MYH1 antibody was raised against the N terminal of MYH1

Purification: Affinity purified

Immunogène: MYH1 antibody was raised using the N terminal of MYH1 corresponding to a region with amino acids KTSVFVVDPKESFVKATVQSREGGKVTAKTEAGATVTVKDDQVFPMNPPK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MYH1 Blocking Peptide, (ABIN940081), is also available for use as a blocking control in assays to test for specificity of this MYH1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MYH1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MYH1

Antigène: MYH1 (Myosin Heavy Chain 1, Skeletal Muscle, Adult (MYH1))

Autre désignation: MYH1

Sujet: Myosin is a major contractile protein which converts chemical energy into mechanical energy through the hydrolysis of ATP.

Poids moléculaire: 223 kDa (MW of target protein)