LGALS14 anticorps (N-Term)

N° du produit ABIN632507

Détail du produit anti-LGALS14 anticorps

Antigène: LGALS14 (Lectin, Galactoside-Binding, Soluble, 14 (LGALS14))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LGALS14 est non-conjugé

Application: Western Blotting (WB)

Specificité: LGALS14 antibody was raised against the N terminal of LGALS14

Purification: Affinity purified

Immunogène: LGALS14 antibody was raised using the N terminal of LGALS14 corresponding to a region with amino acids MSSLPVPYTLPVSLPVGSCVIITGTPILTFVKDPQLEVNFYTGMDEDSDI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LGALS14 Blocking Peptide, catalog no. 33R-6502, is also available for use as a blocking control in assays to test for specificity of this LGALS14 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LGALS14 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LGALS14

Antigène: LGALS14 (Lectin, Galactoside-Binding, Soluble, 14 (LGALS14))

Autre désignation: LGALS14 (LGALS14 Produits)

Synonymes: anticorps CLC2, anticorps PPL13, anticorps galectin 14, anticorps lectin, galactoside-binding, soluble, 14, anticorps galectin-14, anticorps LGALS14, anticorps LOC443162

Sujet: This gene is predominantly expressed in placenta. The encoded protein belongs to the galectin (galaptin/S-lectin) family. The members of galectin family contain one or two carbohydrate recognition domains, which can bind beta-galactoside.

Poids moléculaire: 16 kDa (MW of target protein)