HSPA4L anticorps (C-Term)

N° du produit ABIN632518

Détail du produit anti-HSPA4L anticorps

Antigène: HSPA4L (Heat Shock 70kDa Protein 4-Like (HSPA4L))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HSPA4L est non-conjugé

Application: Western Blotting (WB)

Specificité: HSPA4 L antibody was raised against the C terminal of HSPA4

Purification: Affinity purified

Immunogène: HSPA4 L antibody was raised using the C terminal of HSPA4 corresponding to a region with amino acids KDERYDHLDPTEMEKVEKCISDAMSWLNSKMNAQNKLSLTQDPVVKVSEI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HSPA4L Blocking Peptide, catalog no. 33R-4284, is also available for use as a blocking control in assays to test for specificity of this HSPA4L antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSPA0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HSPA4L

Antigène: HSPA4L (Heat Shock 70kDa Protein 4-Like (HSPA4L))

Autre désignation: HSPA4L (HSPA4L Produits)

Synonymes: anticorps APG-1, anticorps HSPH3, anticorps Osp94, anticorps 94kDa, anticorps AI461691, anticorps OSP94, anticorps heat shock protein family A (Hsp70) member 4 like, anticorps heat shock protein 4 like, anticorps HSPA4L, anticorps Hspa4l

Sujet: HSPA4L belongs to the heat shock protein 70 family. HSPA4L possesses chaperone activity in vitro where it inhibits aggregation of citrate synthase.

Poids moléculaire: 92 kDa (MW of target protein)