CLPB anticorps
-
- Antigène Voir toutes CLPB Anticorps
- CLPB (ClpB Caseinolytic Peptidase B Homolog (CLPB))
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CLPB est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- CLPB antibody was raised using a synthetic peptide corresponding to a region with amino acids ELIQLVNKELNFWAKRAKQRHNITLLWDREVADVLVDGYNVHYGARSIKH
- Top Product
- Discover our top product CLPB Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CLPB Blocking Peptide, catalog no. 33R-2555, is also available for use as a blocking control in assays to test for specificity of this CLPB antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLPB antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CLPB (ClpB Caseinolytic Peptidase B Homolog (CLPB))
- Autre désignation
- CLPB (CLPB Produits)
- Synonymes
- anticorps HSP78, anticorps SKD3, anticorps AL118244, anticorps Skd3, anticorps ClpB homolog, mitochondrial AAA ATPase chaperonin, anticorps ClpB caseinolytic peptidase B, anticorps CLPB, anticorps Clpb
- Sujet
- CLPB may function as a regulatory ATPase and be related to secretion/protein trafficking process.
- Poids moléculaire
- 78 kDa (MW of target protein)
-