Retinoic Acid Induced 12 (RAI12) (C-Term) anticorps
-
- Antigène Voir toutes Retinoic Acid Induced 12 (RAI12) Anticorps
- Retinoic Acid Induced 12 (RAI12)
-
Épitope
- C-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Inconjugué
-
Application
- Western Blotting (WB)
- Specificité
- C17 ORF81 antibody was raised against the C terminal Of C17 rf81
- Purification
- Affinity purified
- Immunogène
- C17 ORF81 antibody was raised using the C terminal Of C17 rf81 corresponding to a region with amino acids FSILPDFSLDLQEGPSVESQPYSDPHIPPVSKNAKARTRKCSLVSGHGRE
- Top Product
- Discover our top product RAI12 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
C17ORF81 Blocking Peptide, catalog no. 33R-3064, is also available for use as a blocking control in assays to test for specificity of this C17ORF81 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF81 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Retinoic Acid Induced 12 (RAI12)
- Autre désignation
- C17ORF81 (RAI12 Produits)
- Synonymes
- anticorps C17orf81, anticorps DERP6, anticorps MST071, anticorps MSTP071, anticorps Derp6, anticorps Rai12, anticorps derp6, anticorps rai12, anticorps zgc:158278, anticorps zgc:158285, anticorps elongator acetyltransferase complex subunit 5, anticorps ELP5, anticorps Elp5, anticorps elp5
- Sujet
- C17orf81 belongs to the ELP5 family. C17orf81 may be involved in TP53-mediated transcriptional regulation.
- Poids moléculaire
- 31 kDa (MW of target protein)
-