BIVM anticorps (Middle Region)

N° du produit ABIN632536

Cet anticorps Lapin Polyclonal détecte spécifiquement BIVM dans WB. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour BIVM anticorps (Middle Region) (ABIN632536)

Antigène: BIVM (Basic, Immunoglobulin-Like Variable Motif Containing (BIVM))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp BIVM est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-BIVM anticorps

Épitope: Middle Region

Specificité: BIVM antibody was raised against the middle region of BIVM

Purification: Affinity purified

Immunogène: BIVM antibody was raised using the middle region of BIVM corresponding to a region with amino acids LYKPHGKNKTAGETASGALSKLTRGLKDESLAYIYHCQNHYFCPIGFEAT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

BIVM Blocking Peptide, (ABIN5612334), is also available for use as a blocking control in assays to test for specificity of this BIVM antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BIVM antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur BIVM

Antigène: BIVM (Basic, Immunoglobulin-Like Variable Motif Containing (BIVM))

Autre désignation: BIVM

Sujet: The function of BIVM protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 57 kDa (MW of target protein)