GAS8 anticorps (N-Term)

N° du produit ABIN632541

Cet anticorps anti-GAS8 est un anticorps Lapin Polyclonal détectant GAS8 dans WB. Adapté pour Humain.

Aperçu rapide pour GAS8 anticorps (N-Term) (ABIN632541)

Antigène: GAS8 (Growth Arrest-Specific 8 (GAS8))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GAS8 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-GAS8 anticorps

Épitope: N-Term

Specificité: GAS8 antibody was raised against the N terminal of GAS8

Purification: Affinity purified

Immunogène: GAS8 antibody was raised using the N terminal of GAS8 corresponding to a region with amino acids VSRIREELDREREERNYFQLERDKIHTFWEITRRQLEEKKAELRNKDREM

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GAS8 Blocking Peptide, (ABIN5613729), is also available for use as a blocking control in assays to test for specificity of this GAS8 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GAS8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GAS8

Antigène: GAS8 (Growth Arrest-Specific 8 (GAS8))

Autre désignation: GAS8

Sujet: This gene includes 11 exons spanning 25 kb and maps to a region of chromosome 16 that is sometimes deleted in breast and prostrate cancer. The second intron contains an apparently intronless gene, C16orf3, that is transcribed in the opposite orientation. This gene is a putative tumor suppressor gene.

Poids moléculaire: 56 kDa (MW of target protein)