ARL13B anticorps (Middle Region)

N° du produit ABIN632542

Détail du produit anti-ARL13B anticorps

Antigène: ARL13B (ADP-Ribosylation Factor-Like 13B (ARL13B))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ARL13B est non-conjugé

Application: Western Blotting (WB)

Specificité: ARL13 B antibody was raised against the middle region of ARL13

Purification: Affinity purified

Immunogène: ARL13 B antibody was raised using the middle region of ARL13 corresponding to a region with amino acids RVEPLNIDDCAPESPTPPPPPPPVGWGTPKVTRLPKLEPLGETHHNDFYR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ARL13B Blocking Peptide, catalog no. 33R-8244, is also available for use as a blocking control in assays to test for specificity of this ARL13B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARL10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ARL13B

Antigène: ARL13B (ADP-Ribosylation Factor-Like 13B (ARL13B))

Autre désignation: ARL13B (ARL13B Produits)

Synonymes: anticorps ARL2L1, anticorps MGC185757, anticorps arl2l1, anticorps chunp6872, anticorps fc23g07, anticorps wu:fc23g07, anticorps zgc:123149, anticorps JBTS8, anticorps A530097K21Rik, anticorps A930014M17Rik, anticorps Arl2l1, anticorps C530009C10Rik, anticorps hnn, anticorps ADP-ribosylation factor like GTPase 13B, anticorps ADP ribosylation factor like GTPase 13B, anticorps ADP-ribosylation factor-like 13b, anticorps ADP-ribosylation factor-like 13B, anticorps Arl13b, anticorps ARL13B, anticorps arl13b

Sujet: ARL13B has an evolutionarily conserved role mediating cilia function in multiple organs. N and C domains of ARL13B cooperatively regulate its ciliary localization and that N domain-dependent self-association of Arl13b may be important for its function in cilia biogenesis.

Poids moléculaire: 37 kDa (MW of target protein)