CHCHD1 anticorps (N-Term)

N° du produit ABIN632544

Détail du produit anti-CHCHD1 anticorps

Antigène: CHCHD1 (Coiled-Coil-Helix-Coiled-Coil-Helix Domain Containing 1 (CHCHD1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CHCHD1 est non-conjugé

Application: Western Blotting (WB)

Specificité: CHCHD1 antibody was raised against the N terminal of CHCHD1

Purification: Affinity purified

Immunogène: CHCHD1 antibody was raised using the N terminal of CHCHD1 corresponding to a region with amino acids MATPSLRGRLARFGNPRKPVLKPNKPLILANRVGERRREKGEATCITEMS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CHCHD1 Blocking Peptide, catalog no. 33R-5787, is also available for use as a blocking control in assays to test for specificity of this CHCHD1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHCHD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CHCHD1

Antigène: CHCHD1 (Coiled-Coil-Helix-Coiled-Coil-Helix Domain Containing 1 (CHCHD1))

Autre désignation: CHCHD1 (CHCHD1 Produits)

Synonymes: anticorps c2360, anticorps MGC97719, anticorps im:7162785, anticorps zgc:162640, anticorps C10orf34, anticorps C2360, anticorps 1110001O19Rik, anticorps 2400010G13Rik, anticorps coiled-coil-helix-coiled-coil-helix domain containing 1, anticorps coiled-coil-helix-coiled-coil-helix domain containing 1 L homeolog, anticorps Chchd1, anticorps chchd1.L, anticorps CHCHD1, anticorps chchd1

Sujet: The function of CHCHD protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 13 kDa (MW of target protein)