WFDC1 anticorps (Middle Region)

N° du produit ABIN632551

Détail du produit anti-WFDC1 anticorps

Antigène: WFDC1 (WAP Four-Disulfide Core Domain 1 (WFDC1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp WFDC1 est non-conjugé

Application: Western Blotting (WB)

Specificité: WFDC1 antibody was raised against the middle region of WFDC1

Purification: Affinity purified

Immunogène: WFDC1 antibody was raised using the middle region of WFDC1 corresponding to a region with amino acids VAEGIPNRGQCVKQRRQADGRILRHKLYKEYPEGDSKNVAEPGRGQQKHF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

WFDC1 Blocking Peptide, catalog no. 33R-9410, is also available for use as a blocking control in assays to test for specificity of this WFDC1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WFDC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur WFDC1

Antigène: WFDC1 (WAP Four-Disulfide Core Domain 1 (WFDC1))

Autre désignation: WFDC1 (WFDC1 Produits)

Synonymes: anticorps WFDC1, anticorps zgc:158671, anticorps PS20, anticorps 2310058A03Rik, anticorps ps20, anticorps WAP four-disulfide core domain 1, anticorps WFDC1, anticorps wfdc1, anticorps Wfdc1

Sujet: This gene encodes a member of the WAP-type four disulfide core domain family. The WAP-type four-disulfide core domain, or WAP signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor in many family members. The encoded protein shares 81% amino acid identity with the rat ps20 protein, which was originally identified as a secreted growth inhibitor. This gene is mapped to chromosome 16q24, an area of frequent loss of heterozygosity in cancers, including prostate, breast and hepatocellular cancers and Wilms' tumor. Owing to its location and a possible growth inhibitory property of its gene product, this gene is suggested to be a tumor suppressor gene.

Poids moléculaire: 21 kDa (MW of target protein)