CRTAC1 anticorps (N-Term)

N° du produit ABIN632560

Cet anticorps Lapin Polyclonal détecte spécifiquement CRTAC1 dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour CRTAC1 anticorps (N-Term) (ABIN632560)

Antigène: CRTAC1 (Cartilage Acidic Protein 1 (CRTAC1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CRTAC1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-CRTAC1 anticorps

Épitope: N-Term

Specificité: CRTAC1 antibody was raised against the N terminal of CRTAC1

Purification: Affinity purified

Immunogène: CRTAC1 antibody was raised using the N terminal of CRTAC1 corresponding to a region with amino acids FTAVTNSVLPPDYDSNPTQLNYGVAVTDVDHDGDFEIVVAGYNGPNLVLK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CRTAC1 Blocking Peptide, (ABIN938471), is also available for use as a blocking control in assays to test for specificity of this CRTAC1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRTAC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CRTAC1

Antigène: CRTAC1 (Cartilage Acidic Protein 1 (CRTAC1))

Autre désignation: CRTAC1

Sujet: The function of CRTAC protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 71 kDa (MW of target protein)