CRTAC1 anticorps (N-Term)
-
- Antigène Voir toutes CRTAC1 Anticorps
- CRTAC1 (Cartilage Acidic Protein 1 (CRTAC1))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CRTAC1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CRTAC1 antibody was raised against the N terminal of CRTAC1
- Purification
- Affinity purified
- Immunogène
- CRTAC1 antibody was raised using the N terminal of CRTAC1 corresponding to a region with amino acids FTAVTNSVLPPDYDSNPTQLNYGVAVTDVDHDGDFEIVVAGYNGPNLVLK
- Top Product
- Discover our top product CRTAC1 Anticorps primaire
-
anti-Cartilage Acidic Protein 1 (CRTAC1) (AA 309-661) antibody
CRTAC1 Reactivité: Humain WB, ELISA Hôte: Lapin Polyclonal unconjugated
anti-Cartilage Acidic Protein 1 (CRTAC1) (AA 130-156), (N-Term) antibodyCRTAC1 Reactivité: Humain WB Hôte: Lapin Polyclonal RB38216 unconjugated
anti-Cartilage Acidic Protein 1 (CRTAC1) antibodyCRTAC1 Reactivité: Souris WB Hôte: Lapin Polyclonal unconjugated
anti-Cartilage Acidic Protein 1 (CRTAC1) (AA 1-451) antibodyCRTAC1 Reactivité: Humain WB Hôte: Souris Polyclonal unconjugated
anti-Cartilage Acidic Protein 1 (CRTAC1) (AA 312-661) antibodyCRTAC1 Reactivité: Humain WB Hôte: Lapin Polyclonal unconjugated
anti-Cartilage Acidic Protein 1 (CRTAC1) (AA 35-84) antibodyCRTAC1 Reactivité: Humain, Souris, Rat, Cheval, Lapin, Boeuf (Vache), Chien, Poisson zèbre (Danio rerio), Cobaye, Singe, Porc, Poulet WB Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CRTAC1 Blocking Peptide, catalog no. 33R-3085, is also available for use as a blocking control in assays to test for specificity of this CRTAC1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRTAC1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CRTAC1 (Cartilage Acidic Protein 1 (CRTAC1))
- Autre désignation
- CRTAC1 (CRTAC1 Produits)
- Synonymes
- anticorps ASPIP, anticorps cb184, anticorps crtac1, anticorps sb:cb184, anticorps zgc:165343, anticorps aspic1, anticorps cep-68, anticorps MGC146658, anticorps ASPIC, anticorps ASPIC1, anticorps CEP-68, anticorps 2810454P21Rik, anticorps AW047536, anticorps Crtac1B, anticorps Lotus, anticorps W307, anticorps cartilage acidic protein 1, anticorps cartilage acidic protein 1a, anticorps CRTAC1, anticorps crtac1a, anticorps crtac1, anticorps aspip, anticorps Crtac1
- Sujet
- The function of CRTAC protein is not widely studied, and is yet to be elucidated fully.
- Poids moléculaire
- 71 kDa (MW of target protein)
-
