Carboxypeptidase X anticorps

N° du produit ABIN632563

Cet anticorps Lapin Polyclonal détecte spécifiquement Carboxypeptidase X dans WB. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour Carboxypeptidase X anticorps (ABIN632563)

Antigène: Carboxypeptidase X

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Application: Western Blotting (WB)

Détail du produit

Purification: Affinity purified

Immunogène: Carboxypeptidase X antibody was raised using a synthetic peptide corresponding to a region with amino acids MNDFSYLHTNCFEVTVELSCDKFPHENELPQEWENNKDALLTYLEQVRMG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Carboxypeptidase X Blocking Peptide, (ABIN5612619), is also available for use as a blocking control in assays to test for specificity of this Carboxypeptidase X antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPXM1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détail du antigène

Antigène: Carboxypeptidase X

Sujet: This gene likely encodes a member of the carboxypeptidase family of proteins. Cloning of a comparable locus in mouse indicates that the encoded protein contains a discoidin domain and a carboxypeptidase domain, but the protein appears to lack residues necessary for carboxypeptidase activity.

Poids moléculaire: 80 kDa (MW of target protein)