PRSS22 anticorps (N-Term)

N° du produit ABIN632566

Détail du produit anti-PRSS22 anticorps

Antigène: PRSS22 (Protease, serine, 22 (PRSS22))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PRSS22 est non-conjugé

Application: Western Blotting (WB)

Specificité: PRSS22 antibody was raised against the N terminal of PRSS22

Purification: Affinity purified

Immunogène: PRSS22 antibody was raised using the N terminal of PRSS22 corresponding to a region with amino acids IPVPPACGKPQQLNRVVGGEDSTDSEWPWIVSIQKNGTHHCAGSLLTSRW

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PRSS22 Blocking Peptide, catalog no. 33R-4104, is also available for use as a blocking control in assays to test for specificity of this PRSS22 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRSS22 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PRSS22

Antigène: PRSS22 (Protease, serine, 22 (PRSS22))

Autre désignation: PRSS22 (PRSS22 Produits)

Synonymes: anticorps BSSP-4, anticorps hBSSP-4, anticorps 4733401N09Rik, anticorps SP001LA, anticorps protease, serine, 22, anticorps protease, serine 22, anticorps Prss22, anticorps PRSS22

Sujet: This gene encodes a member of the trypsin family of serine proteases. The enzyme is expressed in the airways in a developmentally regulated manner. The gene is part of a cluster of serine protease genes on chromosome 16.

Poids moléculaire: 34 kDa (MW of target protein)