ARHGAP30 anticorps (N-Term)

N° du produit ABIN632572

Détail du produit anti-ARHGAP30 anticorps

Antigène: ARHGAP30 (rho GTPase Activating Protein 30 (ARHGAP30))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ARHGAP30 est non-conjugé

Application: Western Blotting (WB)

Specificité: ARHGAP30 antibody was raised against the N terminal of ARHGAP30

Purification: Affinity purified

Immunogène: ARHGAP30 antibody was raised using the N terminal of ARHGAP30 corresponding to a region with amino acids RKWRSIFNLGRSGHETKRKLPRGAEDREDKSNKGTLRPAKSMDSLSAAAG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ARHGAP30 Blocking Peptide, catalog no. 33R-8013, is also available for use as a blocking control in assays to test for specificity of this ARHGAP30 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARHGAP30 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ARHGAP30

Antigène: ARHGAP30 (rho GTPase Activating Protein 30 (ARHGAP30))

Autre désignation: ARHGAP30 (ARHGAP30 Produits)

Synonymes: anticorps 6030405P05Rik, anticorps Gm102, anticorps mFLJ00267, anticorps Rho GTPase activating protein 30, anticorps ARHGAP30, anticorps Arhgap30

Sujet: ARHGAP30 is a GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state.

Poids moléculaire: 98 kDa (MW of target protein)