TGDS anticorps (Middle Region)

N° du produit ABIN632577

Détail du produit anti-TGDS anticorps

Antigène: TGDS (TDP-Glucose 4,6-Dehydratase (TGDS))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TGDS est non-conjugé

Application: Western Blotting (WB)

Specificité: TGDS antibody was raised against the middle region of TGDS

Purification: Affinity purified

Immunogène: TGDS antibody was raised using the middle region of TGDS corresponding to a region with amino acids DEVYGGSLDKEFDESSPKQPTNPYASSKAAAECFVQSYWEQYKFPVVITR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TGDS Blocking Peptide, catalog no. 33R-1924, is also available for use as a blocking control in assays to test for specificity of this TGDS antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TGDS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TGDS

Antigène: TGDS (TDP-Glucose 4,6-Dehydratase (TGDS))

Autre désignation: TGDS (TGDS Produits)

Synonymes: anticorps SDR2E1, anticorps TDPGD, anticorps 2610017J16Rik, anticorps 2610025M23Rik, anticorps AI648925, anticorps TDP-glucose 4,6-dehydratase, anticorps TGDS, anticorps Tgds

Sujet: The function of TGDS protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 40 kDa (MW of target protein)