C18ORF25 anticorps (N-Term)

N° du produit ABIN632578

Cet anticorps Lapin Polyclonal détecte spécifiquement C18ORF25 dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour C18ORF25 anticorps (N-Term) (ABIN632578)

Antigène: C18ORF25 (Chromosome 18 Open Reading Frame 25 (C18ORF25))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C18ORF25 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-C18ORF25 anticorps

Épitope: N-Term

Specificité: C18 orf25 antibody was raised against the N terminal of C18 rf25

Purification: Affinity purified

Immunogène: C18 orf25 antibody was raised using the N terminal of C18 rf25 corresponding to a region with amino acids MKMEEAVGKVEELIESEAPPKASEQETAKEEDGSVELESQVQKDGVADST

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C18orf25 Blocking Peptide, (ABIN5612434), is also available for use as a blocking control in assays to test for specificity of this C18orf25 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 rf25 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C18ORF25

Antigène: C18ORF25 (Chromosome 18 Open Reading Frame 25 (C18ORF25))

Autre désignation: C18orf25

Sujet: The function of C18orf25 protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 37 kDa (MW of target protein)