TMEM42 anticorps (N-Term)

N° du produit ABIN632584

Détail du produit anti-TMEM42 anticorps

Antigène: TMEM42 (Transmembrane Protein 42 (TMEM42))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMEM42 est non-conjugé

Application: Western Blotting (WB)

Specificité: TMEM42 antibody was raised against the N terminal of TMEM42

Purification: Affinity purified

Immunogène: TMEM42 antibody was raised using the N terminal of TMEM42 corresponding to a region with amino acids MAERPGPPGGAVSATAYPDTPAEFPPHLQAGAMRRRFWGVFNCLCAGAFG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMEM42 Blocking Peptide, catalog no. 33R-5645, is also available for use as a blocking control in assays to test for specificity of this TMEM42 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM42 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMEM42

Antigène: TMEM42 (Transmembrane Protein 42 (TMEM42))

Autre désignation: TMEM42 (TMEM42 Produits)

Synonymes: anticorps 0610027O18Rik, anticorps 4933429E06Rik, anticorps AV003444, anticorps D9Ertd662e, anticorps transmembrane protein 42, anticorps TMEM42, anticorps Tmem42

Sujet: The function of TMEM42 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 17 kDa (MW of target protein)