WDFY1 anticorps (N-Term)

N° du produit ABIN632585

L’anticorps Lapin Polyclonal anti-WDFY1 a été validé pour WB. Il convient pour détecter WDFY1 dans des échantillons de Humain.

Aperçu rapide pour WDFY1 anticorps (N-Term) (ABIN632585)

Antigène: WDFY1 (WD Repeat and FYVE Domain Containing 1 (WDFY1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp WDFY1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-WDFY1 anticorps

Épitope: N-Term

Specificité: WDFY1 antibody was raised against the N terminal of WDFY1

Purification: Affinity purified

Immunogène: WDFY1 antibody was raised using the N terminal of WDFY1 corresponding to a region with amino acids MAAEIHSRPQSSRPVLLSKIEGHQDAVTAALLIPKEDGVITASEDRTIRV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

WDFY1 Blocking Peptide, (ABIN5616993), is also available for use as a blocking control in assays to test for specificity of this WDFY1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDFY1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur WDFY1

Antigène: WDFY1 (WD Repeat and FYVE Domain Containing 1 (WDFY1))

Autre désignation: WDFY1

Sujet: The FYVE domain mediates the recruitment of proteins involved in membrane trafficking and cell signaling to phosphatidylinositol 3-phosphate (PtdIns(3)P)-containing membranes.

Poids moléculaire: 46 kDa (MW of target protein)