WDFY1 anticorps (N-Term)
-
- Antigène Voir toutes WDFY1 Anticorps
- WDFY1 (WD Repeat and FYVE Domain Containing 1 (WDFY1))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp WDFY1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- WDFY1 antibody was raised against the N terminal of WDFY1
- Purification
- Affinity purified
- Immunogène
- WDFY1 antibody was raised using the N terminal of WDFY1 corresponding to a region with amino acids MAAEIHSRPQSSRPVLLSKIEGHQDAVTAALLIPKEDGVITASEDRTIRV
- Top Product
- Discover our top product WDFY1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
WDFY1 Blocking Peptide, catalog no. 33R-5591, is also available for use as a blocking control in assays to test for specificity of this WDFY1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDFY1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- WDFY1 (WD Repeat and FYVE Domain Containing 1 (WDFY1))
- Autre désignation
- WDFY1 (WDFY1 Produits)
- Synonymes
- anticorps FENS-1, anticorps WDF1, anticorps ZFYVE17, anticorps 1700013B03Rik, anticorps 1700120F24Rik, anticorps Jr1, anticorps mKIAA1435, anticorps MGC93914, anticorps zgc:101764, anticorps zgc:109909, anticorps WD repeat and FYVE domain containing 1, anticorps WDFY1, anticorps Wdfy1, anticorps wdfy1
- Sujet
- The FYVE domain mediates the recruitment of proteins involved in membrane trafficking and cell signaling to phosphatidylinositol 3-phosphate (PtdIns(3)P)-containing membranes.
- Poids moléculaire
- 46 kDa (MW of target protein)
-