WDFY1 anticorps (N-Term)

N° du produit ABIN632585

Détail du produit anti-WDFY1 anticorps

Antigène: WDFY1 (WD Repeat and FYVE Domain Containing 1 (WDFY1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp WDFY1 est non-conjugé

Application: Western Blotting (WB)

Specificité: WDFY1 antibody was raised against the N terminal of WDFY1

Purification: Affinity purified

Immunogène: WDFY1 antibody was raised using the N terminal of WDFY1 corresponding to a region with amino acids MAAEIHSRPQSSRPVLLSKIEGHQDAVTAALLIPKEDGVITASEDRTIRV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

WDFY1 Blocking Peptide, catalog no. 33R-5591, is also available for use as a blocking control in assays to test for specificity of this WDFY1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDFY1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur WDFY1

Antigène: WDFY1 (WD Repeat and FYVE Domain Containing 1 (WDFY1))

Autre désignation: WDFY1 (WDFY1 Produits)

Synonymes: anticorps FENS-1, anticorps WDF1, anticorps ZFYVE17, anticorps 1700013B03Rik, anticorps 1700120F24Rik, anticorps Jr1, anticorps mKIAA1435, anticorps MGC93914, anticorps zgc:101764, anticorps zgc:109909, anticorps WD repeat and FYVE domain containing 1, anticorps WDFY1, anticorps Wdfy1, anticorps wdfy1

Sujet: The FYVE domain mediates the recruitment of proteins involved in membrane trafficking and cell signaling to phosphatidylinositol 3-phosphate (PtdIns(3)P)-containing membranes.

Poids moléculaire: 46 kDa (MW of target protein)