DUS1L anticorps

N° du produit ABIN632586

Détail du produit anti-DUS1L anticorps

Antigène: DUS1L (Dihydrouridine Synthase 1-Like (DUS1L))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DUS1L est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: DUS1 L antibody was raised using a synthetic peptide corresponding to a region with amino acids KPTGDLPFHWICQPYIRPGPREGSKEKAGARSKRALEEEEGGTEVLSKNK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DUS1L Blocking Peptide, catalog no. 33R-4595, is also available for use as a blocking control in assays to test for specificity of this DUS1L antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DUS0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DUS1L

Antigène: DUS1L (Dihydrouridine Synthase 1-Like (DUS1L))

Autre désignation: DUS1L (DUS1L Produits)

Synonymes: anticorps zgc:63748, anticorps wu:fb71f06, anticorps DUS1, anticorps PP3111, anticorps 1110032N12Rik, anticorps Dus1l, anticorps x85, anticorps dihydrouridine synthase 1-like (S. cerevisiae), anticorps dihydrouridine synthase 1 like, anticorps tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)]-like, anticorps dihydrouridine synthase 1-like (S. cerevisiae) pseudogene, anticorps dihydrouridine synthase 1-like, anticorps dus1l, anticorps DUS1L, anticorps LOC745178, anticorps LOC100408764, anticorps Dus1l

Sujet: DUS1L catalyzes the synthesis of dihydrouridine, a modified base found in the D-loop of most tRNAs.

Poids moléculaire: 53 kDa (MW of target protein)