ACBD3 anticorps (N-Term)

N° du produit ABIN632589

Détail du produit anti-ACBD3 anticorps

Antigène: ACBD3 (Acbd3) (Acyl-CoA Binding Domain Containing 3 (Acbd3))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ACBD3 est non-conjugé

Application: Western Blotting (WB)

Specificité: ACBD3 antibody was raised against the N terminal of ACBD3

Purification: Affinity purified

Immunogène: ACBD3 antibody was raised using the N terminal of ACBD3 corresponding to a region with amino acids EARRLEQRWGFGLEELYGLALRFFKEKDGKAFHPTYEEKLKLVALHKQVL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ACBD3 Blocking Peptide, catalog no. 33R-2282, is also available for use as a blocking control in assays to test for specificity of this ACBD3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACBD3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ACBD3

Antigène: ACBD3 (Acbd3) (Acyl-CoA Binding Domain Containing 3 (Acbd3))

Autre désignation: ACBD3 (Acbd3 Produits)

Synonymes: anticorps ACBD3, anticorps 60kDa, anticorps 8430407O11Rik, anticorps D1Ertd10e, anticorps GCP60, anticorps GOLPH1, anticorps Gocap1, anticorps Pap7, anticorps fa20g08, anticorps si:dkey-267p15.1, anticorps wu:fa20g08, anticorps zgc:66303, anticorps GOCAP1, anticorps PAP7, anticorps acbd3, anticorps MGC122176, anticorps T22A6.60, anticorps T22A6_60, anticorps acyl-CoA-binding domain 3, anticorps acyl-CoA binding domain containing 3, anticorps acyl-Coenzyme A binding domain containing 3, anticorps acyl-CoA binding domain containing 3 L homeolog, anticorps acyl-CoA-binding domain 3, anticorps ACBD3, anticorps Acbd3, anticorps acbd3, anticorps acbd3.L, anticorps ACBP3

Sujet: The protein encoded by this gene is involved in the maintenance of Golgi structure and function through its interaction with the integral membrane protein giantin. It may also be involved in the hormonal regulation of steroid formation.

Poids moléculaire: 60 kDa (MW of target protein)