C17orf75 anticorps (Middle Region)

N° du produit ABIN632590

Détail du produit anti-C17orf75 anticorps

Antigène: C17orf75 (Chromosome 17 Open Reading Frame 75 (C17orf75))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C17orf75 est non-conjugé

Application: Western Blotting (WB)

Specificité: C17 orf75 antibody was raised against the middle region of C17 rf75

Purification: Affinity purified

Immunogène: C17 orf75 antibody was raised using the middle region of C17 rf75 corresponding to a region with amino acids KLKAIQDTNNLKRFIRQAEMNHYALFKCYMFLKNCGSGDILLKIVKVEHE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C17orf75 Blocking Peptide, catalog no. 33R-4513, is also available for use as a blocking control in assays to test for specificity of this C17orf75 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 rf75 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C17orf75

Antigène: C17orf75 (Chromosome 17 Open Reading Frame 75 (C17orf75))

Autre désignation: C17orf75 (C17orf75 Produits)

Synonymes: anticorps NJMU-R1, anticorps C17orf75, anticorps DKFZp469B234, anticorps chromosome 18 C17orf75 homolog, anticorps chromosome 17 open reading frame 75 L homeolog, anticorps chromosome 17 open reading frame, human C17orf75, anticorps chromosome 17 open reading frame 75, anticorps RIKEN cDNA 5730455P16 gene, anticorps C18H17orf75, anticorps c17orf75.L, anticorps C17H17orf75, anticorps C17orf75, anticorps 5730455P16Rik

Sujet: The C17orf75 may have a role in spermatogenesis.

Poids moléculaire: 44 kDa (MW of target protein)